PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G165100.1
Common NamePHAVU_007G165100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YB
Protein Properties Length: 152aa    MW: 17047 Da    PI: 5.3391
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G165100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.55.1e-5538133297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqdr+lPianv+rimk++lP nakisk+a+et+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy+eplk yl+kyre
  Phvul.007G165100.1  38 KEQDRLLPIANVGRIMKQTLPPNAKISKEARETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYAEPLKRYLHKYRE 128
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         lege+
  Phvul.007G165100.1 129 LEGER 133
                         **997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5333140IPR009072Histone-fold
SuperFamilySSF471131.23E-4040141IPR009072Histone-fold
PfamPF008085.9E-2843107IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-207189No hitNo description
PROSITE patternPS0068507490IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-2090108No hitNo description
PRINTSPR006151.5E-20109127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MGDNINIGKV LDREGFKYSF TSSTATASDT SEQDGVIKEQ DRLLPIANVG RIMKQTLPPN  60
AKISKEARET MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDICWALATL GFDDYAEPLK  120
RYLHKYRELE GERANQNKGN SYENNNIANI Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4537128192Transcription factor HapC (Eurofung)
4g92_B2e-4537128192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144547.11e-111hypothetical protein PHAVU_007G165100g
SwissprotO822484e-62NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLV7BJ211e-111V7BJ21_PHAVU; Uncharacterized protein
STRINGGLYMA02G17310.12e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-62nuclear factor Y, subunit B5